PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 289aa    MW: 31926.8 Da    PI: 9.233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06182.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
        PK06182.1 14 KGRWTSEEDEILTKYIQSNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.98.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eE++++++++  lG++ W++Ia++++ gRt++++k++w+++l
        PK06182.1  67 RGNISSEEEDIIINLHSTLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.942961IPR017930Myb domain
SuperFamilySSF466892.13E-2811108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002495.5E-141461IPR001005SANT/Myb domain
CDDcd001671.39E-81661No hitNo description
PROSITE profilePS5129424.862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2565116IPR009057Homeodomain-like
SMARTSM007173.1E-1666114IPR001005SANT/Myb domain
PfamPF002496.3E-1567112IPR001005SANT/Myb domain
CDDcd001675.94E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRAPCCEKI GLKKGRWTSE EDEILTKYIQ SNGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SSEEEDIIIN LHSTLGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIHTFR  120
RCNTTHHIHR DQAPTTLPNL VAITKVNLPT PKRKGGRTSR LAMKKNKSTS NNKNNNSNNI  180
IKNDIVSSSS STTTTSSTTT ATSSFHNEKV TVSTDHIINL DDKQKRQLCR CRLEKEEEEE  240
GSGGCGETVV MMLGSVSPAA ATAAAAGGSS SCDEDMLGGH DQLLLLCCX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBM25215497Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9833350.0HG983335.1 Humulus lupulus mRNA for Myb transcription factor (Myb8 gene), cultivar Osvald's 72, clone 4141.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891841.13e-91PREDICTED: transcription factor MYB12
SwissprotO222643e-78MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0D6DR761e-129A0A0D6DR76_HUMLU; Myb transcription factor
STRINGGLYMA02G01740.18e-83(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-71myb domain protein 12